Bioinformatics Miscellaneous
- An isolated population on an island has the following genotypic frequencies :

Assuming that there are only two alleles (A and a) for the gene, the genotypic frequency of AA in the next generation will be ___.
-
View Hint View Answer Discuss in Forum
NA
Correct Option: A
NA
- In an affine gap penalty model, if the gap opening penalty is -20, gap extension penalty is -4 and gap length is 8, the gap score is ___.
-
View Hint View Answer Discuss in Forum
Gap score = 2 × Gap opening penalty + Gap extension penalty – Gap length
Here, Gap opening penalty = –20,
Gap extension penalty = –4 and gap length = 8
Therefore, Gap score = 2 × (–20) – 4 – 8 = – 52Correct Option: C
Gap score = 2 × Gap opening penalty + Gap extension penalty – Gap length
Here, Gap opening penalty = –20,
Gap extension penalty = –4 and gap length = 8
Therefore, Gap score = 2 × (–20) – 4 – 8 = – 52
- The algorithm for BLAST is based on
-
View Hint View Answer Discuss in Forum
The BLAST program sets a size k for k-tuple subwords. The program then looks for diagonals in the comparison matrix between query and search sequence along which many k-tuples match. This program also aims at identifying core similarities for later extension. The core similarity is defined by a window with a certain match density on DNA or with an amino acid similarity score above some threshold for proteins. Independent of the exact definition of the core similarity, BLAST rests on the precomputation of all strings which are in the given sense similar to any position in the query. n BLAST nomenclature this set of strings is called the neighborhood of the query. The code to generate this neighborhood is in fact exceedingly fast.
Correct Option: C
The BLAST program sets a size k for k-tuple subwords. The program then looks for diagonals in the comparison matrix between query and search sequence along which many k-tuples match. This program also aims at identifying core similarities for later extension. The core similarity is defined by a window with a certain match density on DNA or with an amino acid similarity score above some threshold for proteins. Independent of the exact definition of the core similarity, BLAST rests on the precomputation of all strings which are in the given sense similar to any position in the query. n BLAST nomenclature this set of strings is called the neighborhood of the query. The code to generate this neighborhood is in fact exceedingly fast.
- How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences ?
-
View Hint View Answer Discuss in Forum
NA
Correct Option: B
NA
- Identify the file format given below:
>Pl; JMFD
Protein X – Homo sapiens
MKALTARQQEVFDLIRDHISRTLRQQGDWL
-
View Hint View Answer Discuss in Forum
NA
Correct Option: C
NA